PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA61G00405
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 298aa    MW: 34147.2 Da    PI: 6.0768
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA61G00405genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.5e-141055146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W  eEde l++ vk++G+++W++I ++  ++Rt+k+c++rw +
       AA61G00405 10 KGPWKSEEDEVLINHVKKYGPRDWSSIRSKGLLKRTGKSCRLRWVN 55
                     79*************************888779***********87 PP

2Myb_DNA-binding391.9e-1266105344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +++ +E+   +++  ++G++ W++Ia +++ gRt++++k++w
       AA61G00405  66 KFSVDEERTVIELQSEFGNK-WARIATYLP-GRTDNDVKNFW 105
                      7999****************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-21358IPR009057Homeodomain-like
PROSITE profilePS5129420.998561IPR017930Myb domain
SuperFamilySSF466891.17E-278105IPR009057Homeodomain-like
SMARTSM007172.4E-11959IPR001005SANT/Myb domain
CDDcd001671.61E-111257No hitNo description
PfamPF139214.3E-121363No hitNo description
Gene3DG3DSA:1.10.10.604.5E-1759111IPR009057Homeodomain-like
PROSITE profilePS5129417.44362113IPR017930Myb domain
SMARTSM007171.1E-1163111IPR001005SANT/Myb domain
CDDcd001673.37E-966105No hitNo description
PfamPF002491.5E-1166105IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MESKKEEITK GPWKSEEDEV LINHVKKYGP RDWSSIRSKG LLKRTGKSCR LRWVNKLRPN  60
LKNGCKFSVD EERTVIELQS EFGNKWARIA TYLPGRTDND VKNFWSSRQK RLARILHNSS  120
SNEASSSNSR NKIKNKSVRN SFNSSQVSGF GEEMMKILPC SSSVYNLESS SNQIDETLTI  180
PDLGIKLEHQ PFNFCSDLVL PETSLFTESQ TGVEHHQQAI VPFSPESREL LARLEDPFFY  240
DILGAATGDS CEPFSLPQPF FDPLRRCRQI QRDEPDVFLD DFPEDMFDQV DSARSPVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-28711124126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4694681e-117AF469468.1 Arabidopsis thaliana putative transcription factor (MYB125) mRNA, complete cds.
GenBankHM7765211e-117HM776521.1 Arabidopsis thaliana duo pollen 1 (DUO1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010524425.11e-140PREDICTED: transcription factor MYB59
TrEMBLV4LNL01e-139V4LNL0_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.5__2511__AT3G60460.11e-139(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65512842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.11e-129MYB family protein